PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000159011
Common NameMYB111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 239aa    MW: 26928.6 Da    PI: 8.8228
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000159011genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d++k +G g+W++ ++  g++R++k+c++rw +yl
    MDP0000159011 13 KGAWSKQEDQKLIDYIKTHGEGCWRSLPKAAGLHRCGKSCRLRWINYL 60
                     79********************************************97 PP

2Myb_DNA-binding544e-1766110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E+el+++++++lG++ W++Ia +++ gRt++++k++w+++
    MDP0000159011  66 RGNFEQDEEELIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110
                      899*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-24463IPR009057Homeodomain-like
PROSITE profilePS5129417.411860IPR017930Myb domain
SuperFamilySSF466891.31E-2811107IPR009057Homeodomain-like
SMARTSM007171.8E-141262IPR001005SANT/Myb domain
PfamPF002492.4E-151360IPR001005SANT/Myb domain
CDDcd001674.25E-111560No hitNo description
PROSITE profilePS5129426.77761115IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2664116IPR009057Homeodomain-like
SMARTSM007172.2E-1565113IPR001005SANT/Myb domain
PfamPF002493.3E-1566110IPR001005SANT/Myb domain
CDDcd001674.76E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MRKPCCEKEG TNKGAWSKQE DQKLIDYIKT HGEGCWRSLP KAAGLHRCGK SCRLRWINYL  60
RPDIKRGNFE QDEEELIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRKKLIKMGI  120
DPNNHRLNQI IPRPNPQNDS VSPAATSSGS MSNINACTKT PLKSSDDQID HRASEAASVL  180
EDETSGPSSR DLNLDLTIAF PEPSLQVEEG MPKLIKGSNT TAREIETNLQ HLPTLVLFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28131157108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.130620.0bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7727880.0KF772788.1 Malus hybrid cultivar cultivar Radiant MYB111 mRNA, complete cds.
GenBankKJ0263650.0KJ026365.1 Malus spectabilis MYB111 mRNA, complete cds.
GenBankKJ0263660.0KJ026366.1 Malus micromalus MYB111 mRNA, complete cds.
GenBankKJ1268580.0KJ126858.1 Malus hybrid cultivar MYB3 (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001281006.11e-179myb-related protein 308-like
SwissprotQ388512e-77MYB6_ARATH; Transcription repressor MYB6
TrEMBLD9ZJ511e-179D9ZJ51_MALDO; MYB domain class transcription factor
STRINGPOPTR_0017s02990.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.19e-79myb domain protein 6